Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC26A4 (NM_000441) Human Tagged Lenti ORF Clone
RC222532L3 10 µg

SLC26A4 (NM_000441) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PRICKLE3 Adenovirus (Human)
37614051 1.0 mL

PRICKLE3 Adenovirus (Human)

Sign In for Pricing
View Details
Lentiviral human IFI44 shRNA (UAS) - Lentiviral human IFI44 shRNA (UAS, GFP) plasmid
GTR15136018 1 Vial

Lentiviral human IFI44 shRNA (UAS) - Lentiviral human IFI44 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Iqck 3'UTR Luciferase Stable Cell Line
TU110195 1.0 mL

Iqck 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PPP1R12C Human siRNA Oligo Duplex (Locus ID 54776)
SR310229 1 Kit

PPP1R12C Human siRNA Oligo Duplex (Locus ID 54776)

Sign In for Pricing
View Details
C14orf132 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0303005 3x 1.0 µg

C14orf132 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details