Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp1r3b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7080507 1.0 µg DNA

Ppp1r3b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
AdmiRa-Off-mmu-miR-7646-5p Virus
mm6817 1.0 mL

AdmiRa-Off-mmu-miR-7646-5p Virus

Sign In for Pricing
View Details
CD45RA Antibody
V4764-100UG 100 µg

CD45RA Antibody

Sign In for Pricing
View Details
Mouse Renal Tubular Epithelial Cells
ARP0493 0.5 Million

Mouse Renal Tubular Epithelial Cells

Sign In for Pricing
View Details
Mouse TMIE shRNA Plasmid
abx972884-01 150 µg

Mouse TMIE shRNA Plasmid

Sign In for Pricing
View Details
Mouse TMIE shRNA Plasmid
abx972884-02 300 µg

Mouse TMIE shRNA Plasmid

Sign In for Pricing
View Details