Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-Arg-Leu-Arg-Gly-Gly-AMC
HY-P4388-01 1 mg

Z-Arg-Leu-Arg-Gly-Gly-AMC

Sign In for Pricing
View Details
Z-Arg-Leu-Arg-Gly-Gly-AMC
HY-P4388-02 5 mg

Z-Arg-Leu-Arg-Gly-Gly-AMC

Sign In for Pricing
View Details
HAS1 Lentiviral Activation Particles (h2)
sc-401951-LAC-2 200 µL

HAS1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Brix1 (NM_001029915) Rat Tagged Lenti ORF Clone
RR208008L3 10 µg

Brix1 (NM_001029915) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human CCL23 sgRNA gene knockout kit - Lentiviral human CCL23 sgRNA gene knockout kit (100)
GTR15389353 1 Vial

Lentiviral human CCL23 sgRNA gene knockout kit - Lentiviral human CCL23 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Rat P-Selectin (SELP) ELISA Kit
AE20199RA-01 48 Tests

Rat P-Selectin (SELP) ELISA Kit

Sign In for Pricing
View Details