Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin-4 (STX4) Antibody
abx402233-01 50 µL

Syntaxin-4 (STX4) Antibody

Sign In for Pricing
View Details
Syntaxin-4 (STX4) Antibody
abx402233-02 100 µL

Syntaxin-4 (STX4) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Pax6 Antibody (SPM612) [Alexa Fluor 532]
NBP3-11573AF532 0.1 mL

Mouse Monoclonal Pax6 Antibody (SPM612) [Alexa Fluor 532]

Sign In for Pricing
View Details
KLRC1, CT (Killer Cell Lectin-like Receptor Subfamily C Member 1, CD159 Antigen-like Family Member A, CD159a, MGC13374, MGC59791, NK Cell Receptor A, NKG2A, NKG2, NKG2-A/B-activating NK Receptor, NKG2-A/NKG2-B Type II Integral Membrane Protein) (MaxLight 550) discontinued
K1893-09-ML550 100 µL

KLRC1, CT (Killer Cell Lectin-like Receptor Subfamily C Member 1, CD159 Antigen-like Family Member A, CD159a, MGC13374, MGC59791, NK Cell Receptor A, NKG2A, NKG2, NKG2-A/B-activating NK Receptor, NKG2-A/NKG2-B Type II Integral Membrane Protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
UBE2G2 sgRNA CRISPR Lentivector (Human) (Target 1)
K2572002 1.0 µg DNA

UBE2G2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rat Growth Differentiation Factor 6 GDF6 ELISA Kit
BG-RAT11067 1 Each

Rat Growth Differentiation Factor 6 GDF6 ELISA Kit

Sign In for Pricing
View Details