Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Tri-iodothyronine (T3) ELISA Kit
MBS1601535-01 48 Well

Rabbit Tri-iodothyronine (T3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Tri-iodothyronine (T3) ELISA Kit
MBS1601535-02 96 Well

Rabbit Tri-iodothyronine (T3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Tri-iodothyronine (T3) ELISA Kit
MBS1601535-03 5x 96 Well

Rabbit Tri-iodothyronine (T3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Tri-iodothyronine (T3) ELISA Kit
MBS1601535-04 10x 96 Well

Rabbit Tri-iodothyronine (T3) ELISA Kit

Sign In for Pricing
View Details
Mblac1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4784406 1.0 µg DNA

Mblac1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC) discontinued
360214-01 50 µL

F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC) discontinued

Sign In for Pricing
View Details