SIGIRR, Mouse (HEK293, His)
SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.
Product Specifications
Product Name Alternative
SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html
Purity
95.0
Smiles
MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH
Molecular Formula
24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)
Molecular Weight
Approximately 20-40 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
SORT1 (Sortilin, 100kD NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3) (AP)
SORT1 (Sortilin, 100kD NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3) (AP)
DRAK1 (DAP Kinase-related Apoptosis-inducing Protein Kinase 1, Death-associated Protein Kinase-related 1, Serine/threonine Kinase 17a Death Associated Protein Kinase Related 1, STK17A) (FITC) discontinued
ProDynorphin (PDYN) (NM_024411) Human Tagged ORF Clone