Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neoprzewaquinone A discontinued
371724 5 mg

Neoprzewaquinone A discontinued

Sign In for Pricing
View Details
Recombinant Human Leptin Triple Antagonist, Pegylated
7-01189 5 µg

Recombinant Human Leptin Triple Antagonist, Pegylated

Sign In for Pricing
View Details
Mouse Plexin-B1 (PLXNB1) ELISA Kit
abx539356 96 Tests

Mouse Plexin-B1 (PLXNB1) ELISA Kit

Sign In for Pricing
View Details
ZNF256, ID (ZNF256, BMZF3, Zinc finger protein 256, Bone marrow zinc finger 3) (APC) discontinued
044167-APC 200 µL

ZNF256, ID (ZNF256, BMZF3, Zinc finger protein 256, Bone marrow zinc finger 3) (APC) discontinued

Sign In for Pricing
View Details
Anti-PBK antibody
PAab06180 100 µg

Anti-PBK antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TRA2B Antibody
NBP2-15143 0.1 mL

Rabbit Polyclonal TRA2B Antibody

Sign In for Pricing
View Details