Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAL-PÂTISSIER, digital, 0.0-85.0% Brix, 0-45° Baume, pocket refractometer 'PAL' for wine, with ATC, water-repellent
1209542 1 PC

PAL-PÂTISSIER, digital, 0.0-85.0% Brix, 0-45° Baume, pocket refractometer 'PAL' for wine, with ATC, water-repellent

Sign In for Pricing
View Details
ATP6V0E2 Recombinant Protein (Mouse)
RP118073 100 µg

ATP6V0E2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
DGCR8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV623530 1.0 µg DNA

DGCR8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (PE)
253883-PE 100 µL

ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (PE)

Sign In for Pricing
View Details
iFluor® 647 Maleimide
WJY0-LS55 Each

iFluor® 647 Maleimide

Sign In for Pricing
View Details
b2-Microglobulin (B2M)
MBS603726-01 0.1 mL

b2-Microglobulin (B2M)

Sign In for Pricing
View Details