Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Sex-Determining Region Y Protein (SRY) ELISA Kit
MBS9362504 Inquire

Donkey Sex-Determining Region Y Protein (SRY) ELISA Kit

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) Rabbit Polyclonal Antibody
TA323664 100 µL

Cytokeratin 10 (KRT10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTBK1 rabbit pAb
UB-GEN-8343 100 µL

TTBK1 rabbit pAb

Sign In for Pricing
View Details
JNJ-70218902
HY-P991172 1 Each

JNJ-70218902

Sign In for Pricing
View Details
HAUS5 (NM_015302) Human Over-expression Lysate
LS023354-20ug 20 µg

HAUS5 (NM_015302) Human Over-expression Lysate

Sign In for Pricing
View Details
UGT1A6 Rabbit pAb
MBS9148374-01 0.02 mL

UGT1A6 Rabbit pAb

Sign In for Pricing
View Details