SIGIRR, Mouse (HEK293, His)
SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.
Product Specifications
Product Name Alternative
SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html
Purity
95.0
Smiles
MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH
Molecular Formula
24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)
Molecular Weight
Approximately 20-40 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Duck Interferon-Induced Protein With Tetratricopeptide Repeats 2 (IFIT2) ELISA Kit
Human Double-strand-break repair protein rad21-like protein 1, RAD21L1 ELISA Kit
Human Double-strand-break repair protein rad21-like protein 1, RAD21L1 ELISA Kit
Human Double-strand-break repair protein rad21-like protein 1, RAD21L1 ELISA Kit
Human Double-strand-break repair protein rad21-like protein 1, RAD21L1 ELISA Kit