Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5A1P9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV719257 1.0 µg DNA

ATP5A1P9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
TRF4 CRISPR/Cas9 KO Plasmid (h)
sc-411556 20 µg

TRF4 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human F11, N-His
MBS1572930-01 0.1 mg

Recombinant Human F11, N-His

Sign In for Pricing
View Details
Recombinant Human F11, N-His
MBS1572930-02 1 mg

Recombinant Human F11, N-His

Sign In for Pricing
View Details
Recombinant Human F11, N-His
MBS1572930-03 5x 1 mg

Recombinant Human F11, N-His

Sign In for Pricing
View Details
E. coli DnaK (385-638 aa) AssayLite™ Antibody (APC Conjugate)
32859-05161 5x 30 µg

E. coli DnaK (385-638 aa) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details