Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S175 Protein Lysate (Human) with C-Ha Tag
39735031 100 µg

RN5S175 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Nlk sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6643808 1.0 µg DNA

Nlk sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
pCMV-SPORT6-Rnf138 Plasmid
PVT52779 2 µg

pCMV-SPORT6-Rnf138 Plasmid

Sign In for Pricing
View Details
FFPE Tissue Blocks, Breast
CB800721 1 Block

FFPE Tissue Blocks, Breast

Sign In for Pricing
View Details
SDK2-set siRNA/shRNA/RNAi Lentivector (Human)
43267091 4x 500 ng

SDK2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii ATP synthase subunit c (atpE)
MBS7009170-01 0.02 mg

Recombinant Cronobacter sakazakii ATP synthase subunit c (atpE)

Sign In for Pricing
View Details