Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm12253 (NM_001045542) Mouse Tagged ORF Clone
MG212311 10 µg

Gm12253 (NM_001045542) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Layilin (Layn) Protein
abx620542-01 100 µg

Mouse Layilin (Layn) Protein

Sign In for Pricing
View Details
Mouse Layilin (Layn) Protein
abx620542-02 1 mg

Mouse Layilin (Layn) Protein

Sign In for Pricing
View Details
Human TIMP1 activation kit by CRISPRa
GA104879 1 Kit

Human TIMP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal HIF-1 alpha Antibody [Dylight 755]
NB100-479IR 0.1 mL

Rabbit Polyclonal HIF-1 alpha Antibody [Dylight 755]

Sign In for Pricing
View Details
Synphilin 1 (Synphilin-1) (MaxLight 405) discontinued
301484-ML405 100 µL

Synphilin 1 (Synphilin-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details