Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD2 / SRBC Protein, His Tag (MALS verified)
CD2-H5226-50ug 50 µg

Human CD2 / SRBC Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
TIMM8A 3'UTR Luciferase Stable Cell Line
TU025588 1.0 mL

TIMM8A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MST3 (STK24) (NM_003576) Human Tagged Lenti ORF Clone
RC217776L3 10 µg

MST3 (STK24) (NM_003576) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Simax Tall Form Glass Beaker Without Spout 250ml
BEA3400 10 / PCK

Simax Tall Form Glass Beaker Without Spout 250ml

Sign In for Pricing
View Details
Lentiviral human PARVB shRNA (UAS) - Lentiviral human PARVB shRNA (UAS) plasmid
GTR15319438 1 Vial

Lentiviral human PARVB shRNA (UAS) - Lentiviral human PARVB shRNA (UAS) plasmid

Sign In for Pricing
View Details
Girard's Reagent P AR 98%
01278 00100 100 g

Girard's Reagent P AR 98%

Sign In for Pricing
View Details