Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFP Polyclonal Antibody
MBS2554124-01 0.025 mL

AFP Polyclonal Antibody

Sign In for Pricing
View Details
AFP Polyclonal Antibody
MBS2554124-02 0.1 mL

AFP Polyclonal Antibody

Sign In for Pricing
View Details
AFP Polyclonal Antibody
MBS2554124-03 5x 0.1 mL

AFP Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Pentraxin 2/SAP Biotinylated Affinity Purified PAb
BAF2558 50 µg

Mouse Pentraxin 2/SAP Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
MYCLK1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV735658 1.0 µg DNA

MYCLK1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TCEA3, ID (TCEA3, TFIISH, Transcription elongation factor A protein 3, Transcription elongation factor S-II protein 3, Transcription elongation factor TFIIS.h) (APC)
MBS6354349-01 0.2 mL

TCEA3, ID (TCEA3, TFIISH, Transcription elongation factor A protein 3, Transcription elongation factor S-II protein 3, Transcription elongation factor TFIIS.h) (APC)

Sign In for Pricing
View Details