Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ficolin 2 (FCN2) (NM_004108) Human Tagged Lenti ORF Clone
RC210201L4 10 µg

Ficolin 2 (FCN2) (NM_004108) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MER/TYRO3 (Phospho-Tyr753/Tyr685) Rabbit Polyclonal Antibody
E28PP1208 100 µL

MER/TYRO3 (Phospho-Tyr753/Tyr685) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1375568-01 0.02 mg (E-Coli)

Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1375568-02 0.02 mg (Yeast)

Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1375568-03 0.1 mg (E-Coli)

Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1375568-04 0.1 mg (Yeast)

Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details