Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICALL1, CT (MICALL1, KIAA1668, MIRAB13, MICAL-like protein 1, Molecule interacting with Rab13) (MaxLight 490) discontinued
038425-ML490 100 µL

MICALL1, CT (MICALL1, KIAA1668, MIRAB13, MICAL-like protein 1, Molecule interacting with Rab13) (MaxLight 490) discontinued

Sign In for Pricing
View Details
TMEM185B Protein Vector (Human) (pPB-C-His)
PV042741 500 ng

TMEM185B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ALOX5 (ALOX5, 5-LO, 5-LOX, 5LPG, LOG5, MGC163204, 5-Lipoxygenase) discontinued
209492-01 20 µL

ALOX5 (ALOX5, 5-LO, 5-LOX, 5LPG, LOG5, MGC163204, 5-Lipoxygenase) discontinued

Sign In for Pricing
View Details
ALOX5 (ALOX5, 5-LO, 5-LOX, 5LPG, LOG5, MGC163204, 5-Lipoxygenase) discontinued
209492-02 100 µL

ALOX5 (ALOX5, 5-LO, 5-LOX, 5LPG, LOG5, MGC163204, 5-Lipoxygenase) discontinued

Sign In for Pricing
View Details
GIMAP8 Recombinant Protein (Mouse)
RP136490 100 µg

GIMAP8 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCR018C-A (YCR018C-A) , partial
MBS7094747 Inquire

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCR018C-A (YCR018C-A) , partial

Sign In for Pricing
View Details