Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STYXL2 (NM_001080426) Human Over-expression Lysate
LC421643 20 µg

STYXL2 (NM_001080426) Human Over-expression Lysate

Sign In for Pricing
View Details
Olfr399 Mouse Gene Knockout Kit (CRISPR)
KN512094 1 Kit

Olfr399 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Salmonella typhi (LPS) Mouse Monoclonal Antibody [Clone ID: B348M]
AM31668PU-N 1 mg

Salmonella typhi (LPS) Mouse Monoclonal Antibody [Clone ID: B348M]

Sign In for Pricing
View Details
Lentiviral mouse Asah1 shRNA (UAS) - Lentiviral mouseAsah1 shRNA (UAS, GFP) (25)
GTR15136604 1 Vial

Lentiviral mouse Asah1 shRNA (UAS) - Lentiviral mouseAsah1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FAM134A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0746606 1.0 µg DNA

FAM134A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral human ZSWIM9 sgRNA gene knockout kit - Lentiviral human ZSWIM9 sgRNA gene knockout kit (25)
GTR15365412 1 Vial

Lentiviral human ZSWIM9 sgRNA gene knockout kit - Lentiviral human ZSWIM9 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details