Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

T-Cell Surface Glycoprotein CD4 (CD4) Antibody
abx139124 0.1 mg

T-Cell Surface Glycoprotein CD4 (CD4) Antibody

Sign In for Pricing
View Details
PKM2 Recombinant Antibody, APC-Cy7 Conjugated
bsm-61301R-APC-Cy7 100 µL

PKM2 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Vpreb2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3419708 1.0 µg DNA

Vpreb2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
1-Hydroxy-2,3,4,7-tetramethoxyxanthone
AB3553 10 mg

1-Hydroxy-2,3,4,7-tetramethoxyxanthone

Sign In for Pricing
View Details
(threo) 1',2'-Dihydroxyasarone
HY-N15717A 1 Each

(threo) 1',2'-Dihydroxyasarone

Sign In for Pricing
View Details
STAF65 gamma (SUPT7L) Human siRNA Oligo Duplex (Locus ID 9913)
SR306657 1 Kit

STAF65 gamma (SUPT7L) Human siRNA Oligo Duplex (Locus ID 9913)

Sign In for Pricing
View Details