Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gnai2 (NM_008138) Mouse Tagged Lenti ORF Clone
MR205403L3 10 µg

Gnai2 (NM_008138) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CALCA Mouse Monoclonal Antibody [Clone ID: OTI11G4]
CF190008 100 µg

CALCA Mouse Monoclonal Antibody [Clone ID: OTI11G4]

Sign In for Pricing
View Details
Ubxn2b Mouse Gene Knockout Kit (CRISPR)
KN518632 1 Kit

Ubxn2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Narf sgRNA CRISPR Lentivector (Rat) (Target 2)
K7171003 1.0 µg DNA

Narf sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human NOS3 (Nitric Oxide Synthase 3, Endothelial) ELISA Kit
EK241013 96 Well

Human NOS3 (Nitric Oxide Synthase 3, Endothelial) ELISA Kit

Sign In for Pricing
View Details
CD94/KLRD1 Protein, Human, Recombinant (hFc Tag)
PH51533M3-01 100 µg

CD94/KLRD1 Protein, Human, Recombinant (hFc Tag)

Sign In for Pricing
View Details