Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Claudin-3 (CLDN3) ELISA Kit
MBS7226969-01 48 Well

Bovine Claudin-3 (CLDN3) ELISA Kit

Sign In for Pricing
View Details
Bovine Claudin-3 (CLDN3) ELISA Kit
MBS7226969-02 96 Well

Bovine Claudin-3 (CLDN3) ELISA Kit

Sign In for Pricing
View Details
Bovine Claudin-3 (CLDN3) ELISA Kit
MBS7226969-03 5x 96 Well

Bovine Claudin-3 (CLDN3) ELISA Kit

Sign In for Pricing
View Details
Bovine Claudin-3 (CLDN3) ELISA Kit
MBS7226969-04 10x 96 Well

Bovine Claudin-3 (CLDN3) ELISA Kit

Sign In for Pricing
View Details
Mouse St7 ELISA Kit
EF016293 96 Tests

Mouse St7 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) Os06g0144800 Polyclonal Antibody
MBS7195870 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os06g0144800 Polyclonal Antibody

Sign In for Pricing
View Details