Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH1 Rabbit Monoclonal Antibody
E49Y9993 100 µL

ALKBH1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Multiple organ cancer and normal tissue array, including pathology grade, TNM and clinical stage, 6 cases/24 cores
MMO242 6 Cases / 24 Cores

Multiple organ cancer and normal tissue array, including pathology grade, TNM and clinical stage, 6 cases/24 cores

Sign In for Pricing
View Details
ISX 3'UTR Luciferase Stable Cell Line
TU011306 1.0 mL

ISX 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LOC688776 3'UTR Luciferase Stable Cell Line
TU211777 1.0 mL

LOC688776 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Canine Entamoeba histolytica Antigen ELISA Kit
ECE0168 96 Tests

Canine Entamoeba histolytica Antigen ELISA Kit

Sign In for Pricing
View Details
GABPA Polyclonal Antibody
MBS2573089-01 0.06 mL

GABPA Polyclonal Antibody

Sign In for Pricing
View Details