Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Insulin Antibody (9Y413)
MF-0078309-01 50 µL

Anti-Insulin Antibody (9Y413)

Sign In for Pricing
View Details
Anti-Insulin Antibody (9Y413)
MF-0078309-02 100 µL

Anti-Insulin Antibody (9Y413)

Sign In for Pricing
View Details
Human RNF144A Pre-designed siRNA Set B
SI013853B 1 Each

Human RNF144A Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human ARAF shRNA (UAS) - Lentiviral human ARAF shRNA (UAS, GFP) plasmid
GTR15155614 1 Vial

Lentiviral human ARAF shRNA (UAS) - Lentiviral human ARAF shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
C12orf26 (METTL25) (NM_032230) Human Over-expression Lysate
LC410257 20 µg

C12orf26 (METTL25) (NM_032230) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM104A Protein Vector (Rat) (pPM-C-His)
PV267077 500 ng

FAM104A Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details