Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GABPB2 shRNA (UAS) - Lentiviral human GABPB2 shRNA (UAS, iRFP) (25)
GTR15101774 1 Vial

Lentiviral human GABPB2 shRNA (UAS) - Lentiviral human GABPB2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SDF1 Rabbit mAb
MBS4762779-01 0.1 mL

SDF1 Rabbit mAb

Sign In for Pricing
View Details
SDF1 Rabbit mAb
MBS4762779-02 5x 0.1 mL

SDF1 Rabbit mAb

Sign In for Pricing
View Details
Scoparone
SM1117-100mg 100 mg

Scoparone

Sign In for Pricing
View Details
ROR alpha (Nuclear Receptor ROR-alpha, Retinoid-related Orphan Receptor-alpha, Nuclear Receptor RZR-alpha, Nuclear Receptor Subfamily 1 Group F Member 1, NR1F1, RZRA, RORA) (MaxLight 650)
138300-ML650 100 µL

ROR alpha (Nuclear Receptor ROR-alpha, Retinoid-related Orphan Receptor-alpha, Nuclear Receptor RZR-alpha, Nuclear Receptor Subfamily 1 Group F Member 1, NR1F1, RZRA, RORA) (MaxLight 650)

Sign In for Pricing
View Details
CSN1 (GPS1) (NM_212492) Human Tagged ORF Clone Lentiviral Particle
RC209147L2V 200 µL

CSN1 (GPS1) (NM_212492) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details