Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Product Specifications

Product Name Alternative

SIGIRR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sigirr-protein-mouse-hek293-his-hfc.html

Purity

95.0

Smiles

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Molecular Formula

24058 (Gene_ID) Q9JLZ8 (M1-H117) (Accession)

Molecular Weight

Approximately 20-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (6F-H2), CF555 conjugate, 0.1mg/mL
BNC550856-100 1x 100 µL

WT1 (Wilm's Tumor 1) (6F-H2), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (1A4), CF640R conjugate, 0.1mg/mL
BNC400665-500 1x 500 µL

Smooth Muscle Actin (1A4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF488A conjugate, 0.1mg/mL
BNC881537-100 1x 100 µL

Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF568 conjugate, 0.1mg/mL
BNC680988-500 1x 500 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF488A conjugate, 0.1mg/mL
BNC880296-500 1x 500 µL

Blood Group Antigen B (CD173) (HEB-20), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details