Animal-Free IL-21, Human (His)
IL-21 protein is an immunomodulatory cytokine that promotes the transition from innate immunity to adaptive immunity. It induces B cells to produce IgG (1) and IgG (3), harnessing an effective antibody response to fight viral infections. Animal-Free IL-21 Protein, Human (His) is the recombinant human-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-21 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-21-protein-human-his.html
Purity
95.0
Smiles
MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Molecular Formula
59067 (Gene_ID) Q9HBE4-1 (Q32-S162) (Accession)
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Recombinant Emys orbicularis Cytochrome b (MT-CYB), partial
Lentiviral mouse Ankhd1 shRNA (UAS) - Lentiviral mouse Ankhd1 shRNA (UAS, iRFP) (100)
Solute Carrier Family 6 Member 3 Rabbit Monoclonal Antibody [KD Validation]
Human Type 2 DNA Topoisomerase 6 Subunit B-Like (TOP6BL) ELISA Kit