Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP2, Mouse (HEK293, His)

SFRP2 protein has multiple functions such as Wnt protein binding and receptor ligand activity, and regulates gene expression and signal transduction.It functions upstream in animal organ development, signal transduction, and regulation of endopeptidase activity.SFRP2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SFRP2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp2-protein-mouse-hek293-his.html

Purity

98.0

Smiles

LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Molecular Formula

20319 (Gene_ID) NP_033170.1 (L25-C295) (Accession)

Molecular Weight

Approximately 31-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Monoclonal Antibody to Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (Clone : rOV-TL12/30)
12-1005-20 20 µg

Recombinant Mouse Monoclonal Antibody to Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (Clone : rOV-TL12/30)

Sign In for Pricing
View Details
Gm5786 3'UTR GFP Stable Cell Line
TU158296 1.0 mL

Gm5786 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Celf2 ORF Vector (Rat) (pORF)
15854016 1.0 µg DNA

Celf2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Fam54b sgRNA CRISPR Lentivector set (Rat)
K6429501 3x 1.0 µg

Fam54b sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
NPR3 Polyclonal Antibody
MBS8571572-01 0.1 mL

NPR3 Polyclonal Antibody

Sign In for Pricing
View Details
NPR3 Polyclonal Antibody
MBS8571572-02 0.1 mL (AF405L)

NPR3 Polyclonal Antibody

Sign In for Pricing
View Details