TSPO, Mouse (Cell-Free, His)
The TSPO protein was originally thought to be a peripheral benzodiazepine receptor that binds protoporphyrin IX and isoquinoline carboxamide. TSPO Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived TSPO protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Product Specifications
Product Name Alternative
TSPO Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tspo-protein-mouse-cf-his.html
Purity
96.00
Smiles
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE
Molecular Formula
12257 (Gene_ID) P50637 (M1-E169) (Accession)
Molecular Weight
21.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740994-100 1x 100 µL
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details