TSPO, Mouse (Cell-Free, His)
The TSPO protein was originally thought to be a peripheral benzodiazepine receptor that binds protoporphyrin IX and isoquinoline carboxamide. TSPO Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived TSPO protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Product Specifications
Product Name Alternative
TSPO Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tspo-protein-mouse-cf-his.html
Purity
96.00
Smiles
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE
Molecular Formula
12257 (Gene_ID) P50637 (M1-E169) (Accession)
Molecular Weight
21.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-60591R-BF350 100 µL
PAX9 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
Sign In for Pricing
View Details OR1066798-01 50 mg
(2S,4R) -1- ((R) -2-Amino-3,3-dimethylbutanoyl) -4-hydroxy-N- (4- (4-methylthiazol-5-yl) benzyl) pyrrolidine-2-carboxamide hydrochloride
Sign In for Pricing
View Details OR1066798-02 100 mg
(2S,4R) -1- ((R) -2-Amino-3,3-dimethylbutanoyl) -4-hydroxy-N- (4- (4-methylthiazol-5-yl) benzyl) pyrrolidine-2-carboxamide hydrochloride
Sign In for Pricing
View Details OR1066798-03 250 mg
(2S,4R) -1- ((R) -2-Amino-3,3-dimethylbutanoyl) -4-hydroxy-N- (4- (4-methylthiazol-5-yl) benzyl) pyrrolidine-2-carboxamide hydrochloride
Sign In for Pricing
View Details 
bs-11279R-PE-Cy7 100 µL
ESE1 Polyclonal Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details 