Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDM4/MDMX, Human (His)

MDM4/MDMX proteins cooperate with MDM2 to regulate TP53 (p53) and inhibit the transcriptional activation domains of p53 and p73. This hinders their ability to induce cell cycle arrest and apoptosis. MDM4/MDMX Protein, Human (His) is the recombinant human-derived MDM4/MDMX protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

MDM4/MDMX Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdm4-mdmx-protein-human-his.html

Purity

95.00

Smiles

MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQD

Molecular Formula

4194 (Gene_ID) O15151-1/NP_002384.2 (M1-D134) (Accession)

Molecular Weight

Approximately 19.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 Mouse mAb
E2222153 100 µL

CD63 Mouse mAb

Sign In for Pricing
View Details
SLC47A1 Protein Vector (Rat) (pPB-C-His)
PV306206 500 ng

SLC47A1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Phospho-ZAP70 (Tyr315+Tyr319) Polyclonal Antibody
TMAB-11421-01 50 μL

Anti-Phospho-ZAP70 (Tyr315+Tyr319) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-ZAP70 (Tyr315+Tyr319) Polyclonal Antibody
TMAB-11421-02 100 µL

Anti-Phospho-ZAP70 (Tyr315+Tyr319) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-ZAP70 (Tyr315+Tyr319) Polyclonal Antibody
TMAB-11421-03 200 µL

Anti-Phospho-ZAP70 (Tyr315+Tyr319) Polyclonal Antibody

Sign In for Pricing
View Details
ELISA Kit for Brain Natriuretic Peptide (BNP)
TRV-0038139-01 24 Tests

ELISA Kit for Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details