Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Tenascin (TNC), partial

Product Specifications

Product Name Alternative

TN; Cytotactin; GMEM; GP 150-225; Glioma-associated-extracellular matrix antigen; Hexabrachion; JI; Myotendinous antigen; Neuronectin; P230; Tenascin-C; TN-C

Abbreviation

Recombinant Pig TNC protein, partial

Gene Name

TNC

UniProt

Q29116

Expression Region

1520-1735aa

Organism

Sus scrofa (Pig)

Target Sequence

GLLYPFPRDCSQAMLNGDTTSGLYTIYVNNDKAQKLEVFCDMTSDSGGWIVFLRRKNGREDFYRNWKAYAAGFGDLKEEFWLGLDALSKITAQGQYELRVDLRDHGETAYAVYDRFSVGDARTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNSHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Thyrotropin Releasing Hormone (TRH)
TRV-0017301-01 24 Tests

ELISA Kit for Thyrotropin Releasing Hormone (TRH)

Sign In for Pricing
View Details
ELISA Kit for Thyrotropin Releasing Hormone (TRH)
TRV-0017301-02 48 Tests

ELISA Kit for Thyrotropin Releasing Hormone (TRH)

Sign In for Pricing
View Details
ELISA Kit for Thyrotropin Releasing Hormone (TRH)
TRV-0017301-03 96 Tests

ELISA Kit for Thyrotropin Releasing Hormone (TRH)

Sign In for Pricing
View Details
ELISA Kit for Thyrotropin Releasing Hormone (TRH)
TRV-0017301-04 5x 96 Tests

ELISA Kit for Thyrotropin Releasing Hormone (TRH)

Sign In for Pricing
View Details
ELISA Kit for Thyrotropin Releasing Hormone (TRH)
TRV-0017301-05 10x 96 Tests

ELISA Kit for Thyrotropin Releasing Hormone (TRH)

Sign In for Pricing
View Details
BEND4 Protein Vector (Mouse) (pPM-C-His)
PV159269 500 ng

BEND4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details