Adiponectin/Acrp30, Human (HEK293)
Adiponectin/Acrp30 Protein, Human (HEK293) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy.
Product Specifications
Product Name Alternative
Adiponectin/Acrp30 Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Applications
Neuroscience-Neuromodulation
Assay Protocol
https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293.html
Purity
95.00
Smiles
KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Molecular Formula
9370 (Gene_ID) Q15848 (K101-N244) (Accession)
Molecular Weight
Approximately 16-19 kDa due to the glycosylation.
References & Citations
[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040977-500 1x 500 µL
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details