Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (HEK293)

Adiponectin/Acrp30 Protein, Human (HEK293) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy.

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-hek293.html

Purity

95.00

Smiles

KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (K101-N244) (Accession)

Molecular Weight

Approximately 16-19 kDa due to the glycosylation.

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella flexneri serotype 5b Hydroxylamine reductase (hcp), partial
MBS1332913 Inquire

Recombinant Shigella flexneri serotype 5b Hydroxylamine reductase (hcp), partial

Sign In for Pricing
View Details
Rabbit Polyclonal RTF1 Antibody [CoraFluor 1]
NB600-278CL1 0.1 mL

Rabbit Polyclonal RTF1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Fgfbp3 3'UTR GFP Stable Cell Line
TU254617 1.0 mL

Fgfbp3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0266 membrane protein yobD (yobD)
MBS1073734 Inquire

Recombinant Escherichia coli UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details
(7- (4-{4-[4- (2,3-Dichlorophenyl) piperazin-1-yl]butoxy}butoxy-d8) -3,4-dihydroquinolin-2 (1H) -one)
439292 1 mg

(7- (4-{4-[4- (2,3-Dichlorophenyl) piperazin-1-yl]butoxy}butoxy-d8) -3,4-dihydroquinolin-2 (1H) -one)

Sign In for Pricing
View Details
KAP1 Rabbit Monoclonal Antibody
AMRe21494-01 50 µL

KAP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details