Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-A5/EFNA5, Rat (HEK293, His)

The Ephrin-A5/EFNA5 protein is an important cell surface ligand that plays an important role in neuronal, vascular, and epithelial development. It binds to Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion, cytoskeletal organization, and lens transparency. Ephrin-A5/EFNA5 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Ephrin-A5/EFNA5 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-a5-efna5-protein-rat-hek293-his.html

Purity

98.0

Smiles

QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVRDRVFDVNDKVENSLEPADDTVHESAEPSRGE

Molecular Formula

116683 (Gene_ID) P97605 (Q21-E202) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MARCKS (Ser170) Rabbit Polyclonal Antibody (BF750)
orb2411116 100 µL

Phospho-MARCKS (Ser170) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Lentiviral human GTF2I shRNA (UAS) - Lentiviral human GTF2I shRNA (UAS) plasmid
GTR15097603 1 Vial

Lentiviral human GTF2I shRNA (UAS) - Lentiviral human GTF2I shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human Adenylyl Cyclase Associated Protein 1 ELISA Kit
MBS027308-01 48 Well

Human Adenylyl Cyclase Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Adenylyl Cyclase Associated Protein 1 ELISA Kit
MBS027308-02 96 Well

Human Adenylyl Cyclase Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Adenylyl Cyclase Associated Protein 1 ELISA Kit
MBS027308-03 5x 96 Well

Human Adenylyl Cyclase Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Adenylyl Cyclase Associated Protein 1 ELISA Kit
MBS027308-04 10x 96 Well

Human Adenylyl Cyclase Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details