Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nectin-2/CD112, Cynomolgus (HEK293, His)

Nectin-2, a poliovirus receptor-related 2 protein, is a type I transmembrane glycoprotein and a member of the Ig gene superfamily. Nectin-2, also known as CD112, is an adhesion molecule involved in the formation of cell junctions and interactions with other Nectin-family molecules. Nectin-2/CD112 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Nectin-2/CD112 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nectin-2-cd112-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPPDHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTRQDTEAELQDATLALRGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPQNHAEAQEVTFSQDPVPVARCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVHSNPEPTGYDWSTTSGIFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDMGPL

Molecular Formula

713229 (Gene_ID) Q0MSE5/NP_001037058.1 (Q32-L360) (Accession)

Molecular Weight

Approximately 47 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e antibody (FITC)
MBS5318071-01 0.5 mg

CD3e antibody (FITC)

Sign In for Pricing
View Details
CD3e antibody (FITC)
MBS5318071-02 5x 0.5 mg

CD3e antibody (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal TbHsp70 Antibody [Alexa Fluor 532]
NBP3-18236AF532 0.1 mL

Rabbit Polyclonal TbHsp70 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Ornithine aminotransferase/OAT Rabbit Polyclonal Antibody (HRP)
orb2601419 100 µg

Ornithine aminotransferase/OAT Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Galectin-1 (1-135) Human Protein
AR09268PU-L 500 µg

Galectin-1 (1-135) Human Protein

Sign In for Pricing
View Details
GZMB Polyclonal Antibody
ANT-12458-100ug 100 µg

GZMB Polyclonal Antibody

Sign In for Pricing
View Details