Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Haptoglobin (HP)

Product Specifications

Product Name Alternative

Zonulin

Abbreviation

Recombinant Human HP protein

Gene Name

HP

UniProt

P00738

Expression Region

19-406aa

Organism

Homo sapiens (Human)

Target Sequence

VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity, and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.3 kDa

References & Citations

"Nucleotide sequence of the haptoglobin and haptoglobin-related gene pair. The haptoglobin-related gene contains a retrovirus-like element." Maeda N. J. Biol. Chem. 260:6698-6709 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (rCFTR/1342), CF488A conjugate, 0.1mg/mL
BNC882291-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (rCFTR/1342), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human NMD3 activation kit by CRISPRa
GA109534 1 Kit

Human NMD3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS708902 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Rusf1 Mouse Gene Knockout Kit (CRISPR)
KN502014 1 Kit

Rusf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FANCC Mouse Monoclonal Antibody [Clone ID: OTI8A7]
CF811730 100 µg

FANCC Mouse Monoclonal Antibody [Clone ID: OTI8A7]

Sign In for Pricing
View Details
5- (&6) -Carboxy-2', 7'-Dichlorofluorescein
#51015 1x 200 mg

5- (&6) -Carboxy-2', 7'-Dichlorofluorescein

Sign In for Pricing
View Details