Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRG1-beta 2, Human

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 2 Protein, Human is the recombinant human-derived NRG1-beta 2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NRG1-beta 2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nrg-1beta2-protein-human.html

Purity

96.00

Smiles

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Molecular Formula

3084 (Gene_ID) Q02297-7 (S177-Q237) /E5RIG8 (S23-Q83) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LNK (SH2B3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F6]
TA503069BM 100 µL

LNK (SH2B3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F6]

Sign In for Pricing
View Details
Mouse Crx activation kit by CRISPRa
GA200891 1 Kit

Mouse Crx activation kit by CRISPRa

Sign In for Pricing
View Details
General Cortisone (Cor) ELISA Kit
RD-Cor-Ge-01 96 Tests

General Cortisone (Cor) ELISA Kit

Sign In for Pricing
View Details
General Cortisone (Cor) ELISA Kit
RD-Cor-Ge-02 48 Tests

General Cortisone (Cor) ELISA Kit

Sign In for Pricing
View Details
KIAA1486 (NYAP2) Human Gene Knockout Kit (CRISPR)
KN424448 1 Kit

KIAA1486 (NYAP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Desmoglein-2 Antibody
KC-27639-01 50 μL

Desmoglein-2 Antibody

Sign In for Pricing
View Details