Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRG1-beta 2, Human

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 2 Protein, Human is the recombinant human-derived NRG1-beta 2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NRG1-beta 2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nrg-1beta2-protein-human.html

Purity

96.00

Smiles

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Molecular Formula

3084 (Gene_ID) Q02297-7 (S177-Q237) /E5RIG8 (S23-Q83) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA22 (NM_001170696) Human Over-expression Lysate
LY432882 100 µg

SPATA22 (NM_001170696) Human Over-expression Lysate

Sign In for Pricing
View Details
Clec4a3 Mouse Gene Knockout Kit (CRISPR)
KN503445 1 Kit

Clec4a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DECTIN 2 (CLEC6A) (NM_001007033) Human Over-expression Lysate
LC423570 20 µg

DECTIN 2 (CLEC6A) (NM_001007033) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Ethylbenzofuran
TRC-E899770-5G 5 g

2-Ethylbenzofuran

Sign In for Pricing
View Details
General Purpose Incubator BIGP-6908
BIGP-6908 1 Unit

General Purpose Incubator BIGP-6908

Sign In for Pricing
View Details
(2-Nitrophenyl)hydrazine (Contains ~30-40% water as stabilizer)
TRC-N926130-250MG 250 mg

(2-Nitrophenyl)hydrazine (Contains ~30-40% water as stabilizer)

Sign In for Pricing
View Details