Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRG1-beta 2, Human

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 2 Protein, Human is the recombinant human-derived NRG1-beta 2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NRG1-beta 2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nrg-1beta2-protein-human.html

Purity

96.00

Smiles

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Molecular Formula

3084 (Gene_ID) Q02297-7 (S177-Q237) /E5RIG8 (S23-Q83) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (C68/684), CF740 conjugate, 0.1mg/mL
BNC740684-100 1x 100 µL

CD68 (C68/684), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzo(b)chrysene
TRC-B217000-5MG 5 mg

Benzo(b)chrysene

Sign In for Pricing
View Details
NR2E1 Recombinant Rabbit Monoclonal Antibody [JE38-26]
HA722548 100 µL

NR2E1 Recombinant Rabbit Monoclonal Antibody [JE38-26]

Sign In for Pricing
View Details
5-(2,5-Dihydroxybenzylamino)-2-hydroxybenzoic Acid
TRC-D452000-5MG 5 mg

5-(2,5-Dihydroxybenzylamino)-2-hydroxybenzoic Acid

Sign In for Pricing
View Details
Cd99l2 Mouse Gene Knockout Kit (CRISPR)
KN502954 1 Kit

Cd99l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human DNAH7 activation kit by CRISPRa
GA111151 1 Kit

Human DNAH7 activation kit by CRISPRa

Sign In for Pricing
View Details