Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRG1-beta 2, Human

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 2 Protein, Human is the recombinant human-derived NRG1-beta 2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NRG1-beta 2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nrg-1beta2-protein-human.html

Purity

96.00

Smiles

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Molecular Formula

3084 (Gene_ID) Q02297-7 (S177-Q237) /E5RIG8 (S23-Q83) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F10]
TA504389BM 100 µL

PSMB9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F10]

Sign In for Pricing
View Details
3-(4-Chlorophenyl) Propyl 3-(Piperidin-1-yl) Propanoate
TRC-C242110-100MG 100 mg

3-(4-Chlorophenyl) Propyl 3-(Piperidin-1-yl) Propanoate

Sign In for Pricing
View Details
Mouse Pcp2 activation kit by CRISPRa
GA203122 1 Kit

Mouse Pcp2 activation kit by CRISPRa

Sign In for Pricing
View Details
GFAP Recombinant Monoclonal Mouse Antibody (rGA5), CF®488A Conjugate - Biotium Choice
P046-488A-1ML 1x 1 mL

GFAP Recombinant Monoclonal Mouse Antibody (rGA5), CF®488A Conjugate - Biotium Choice

Sign In for Pricing
View Details
AMHR2 (NM_020547) Human Recombinant Protein
TP312425M 100 µg

AMHR2 (NM_020547) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS809075 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details