Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRG1-beta 2, Human

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 2 Protein, Human is the recombinant human-derived NRG1-beta 2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NRG1-beta 2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nrg-1beta2-protein-human.html

Purity

96.00

Smiles

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Molecular Formula

3084 (Gene_ID) Q02297-7 (S177-Q237) /E5RIG8 (S23-Q83) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pias2 (NM_001164170) Mouse Tagged ORF Clone
MR208919 10 µg

Pias2 (NM_001164170) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Olr300 Protein Vector (Rat) (pPB-C-His)
PV289594 500 ng

Olr300 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
CXCR5 Human shRNA Lentiviral Particle (Locus ID 643)
TL306391V 500 µL Each

CXCR5 Human shRNA Lentiviral Particle (Locus ID 643)

Sign In for Pricing
View Details
AHCYL1 (Putative Adenosylhomocysteinase 2, AdoHcyase 2, DC-expressed AHCY-like Molecule, S-adenosyl-L-homocysteine Hydrolase 2, S-adenosylhomocysteine Hydrolase-like Protein 1, DCAL, XPVKONA) (MaxLight 405) discontinued
123082-ML405 100 µL

AHCYL1 (Putative Adenosylhomocysteinase 2, AdoHcyase 2, DC-expressed AHCY-like Molecule, S-adenosyl-L-homocysteine Hydrolase 2, S-adenosylhomocysteine Hydrolase-like Protein 1, DCAL, XPVKONA) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti - Tankyrase (TRF1 interacting ankyrin-related ADP-ribose polymerase)
MBS600850-01 0.1 mL

Anti - Tankyrase (TRF1 interacting ankyrin-related ADP-ribose polymerase)

Sign In for Pricing
View Details
Anti - Tankyrase (TRF1 interacting ankyrin-related ADP-ribose polymerase)
MBS600850-02 5x 0.1 mL

Anti - Tankyrase (TRF1 interacting ankyrin-related ADP-ribose polymerase)

Sign In for Pricing
View Details