Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8, Mouse (P.pastoris, His)

S100A8 protein plays crucial roles in the immune system and inflammation.It activates NADPH-oxidase, generating reactive oxygen species in immune cells.Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex.S100A8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived S100A8 protein, expressed by P.pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A8 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-protein-mouse-p-pastoris-his.html

Purity

97.00

Smiles

PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

Molecular Formula

20201 (Gene_ID) P27005 (P2-E89) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Mismatch Repair Protein Msh2 (MSH2) Antibody
abx001036-01 60 µL

DNA Mismatch Repair Protein Msh2 (MSH2) Antibody

Sign In for Pricing
View Details
DNA Mismatch Repair Protein Msh2 (MSH2) Antibody
abx001036-02 120 µL

DNA Mismatch Repair Protein Msh2 (MSH2) Antibody

Sign In for Pricing
View Details
DNA Mismatch Repair Protein Msh2 (MSH2) Antibody
abx001036-03 200 µL

DNA Mismatch Repair Protein Msh2 (MSH2) Antibody

Sign In for Pricing
View Details
KIR2DS4 (NM_001281971) Human Untagged Clone
SC334732 10 µg

KIR2DS4 (NM_001281971) Human Untagged Clone

Sign In for Pricing
View Details
Caspase-4 shRNA (h) Lentiviral Particles
sc-72798-V 200 µL

Caspase-4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Myeloid Leukemia Factor 1 (MLF1) Antibody
abx008990-01 30 µL

Myeloid Leukemia Factor 1 (MLF1) Antibody

Sign In for Pricing
View Details