Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8, Mouse (P.pastoris, His)

S100A8 protein plays crucial roles in the immune system and inflammation.It activates NADPH-oxidase, generating reactive oxygen species in immune cells.Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex.S100A8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived S100A8 protein, expressed by P.pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A8 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-protein-mouse-p-pastoris-his.html

Purity

97.00

Smiles

PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

Molecular Formula

20201 (Gene_ID) P27005 (P2-E89) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Receptor Subfamily 2 Group F Member 1 (NR2F1) Antibody
abx235843 100 µg

Nuclear Receptor Subfamily 2 Group F Member 1 (NR2F1) Antibody

Sign In for Pricing
View Details
Stox2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
45767114 3x 1.0 µg

Stox2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Zenidolol hydrochloride (ICI 118,551 hydrochloride) 10mM * 1mL in DMSO
A13225-10mM-D 10 mM x 1mL in DMSO

Zenidolol hydrochloride (ICI 118,551 hydrochloride) 10mM * 1mL in DMSO

Sign In for Pricing
View Details
TOPBP1 Antibody
OACD00783-1ML 1 mL

TOPBP1 Antibody

Sign In for Pricing
View Details
VPS16 Protein Vector (Mouse) (pPM-C-HA)
PV246520 500 ng

VPS16 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Desmocollin 3 (DSC3) Mouse Monoclonal Antibody [Clone ID: Dsc3-U114]
BM5103 50 µg

Desmocollin 3 (DSC3) Mouse Monoclonal Antibody [Clone ID: Dsc3-U114]

Sign In for Pricing
View Details