Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD127/IL-7RA, Cynomolgus (HEK293, His)

IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP) . CD127/IL-7RA Protein, Cynomolgus (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 235 amino acids (M1-P235) [1][2].

Product Specifications

Product Name Alternative

CD127/IL-7RA Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd127-il-7ra-protein-cynomolgus-hek293-his.html

Purity

95.50

Smiles

ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLSFRKLQEIYFIETKKFLLIGKSNICVKVGGKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMHVNLSSTKLTLLQRNLQPEAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSP

Molecular Formula

102143679 (Gene_ID) Q38IC7 (E21-P235) (Accession)

Molecular Weight

Approximately 26.3-50 kDa due to the glycosylation.

References & Citations

[1]Daniel Čierny, et al. Genetic variants in interleukin 7 receptor α chain (IL-7Ra) are associated with multiple sclerosis risk and disability progression in Central European Slovak population. J Neuroimmunol. 2015 May 15;282:80-4.|[2]Renata Mazzucchelli, et al. Interleukin-7 receptor expression: intelligent design. Nat Rev Immunol. 2007 Feb;7 (2) :144-54.|[3]Silvia Giliani, et al. Interleukin-7 receptor alpha (IL-7Ralpha) deficiency: cellular and molecular bases. Analysis of clinical, immunological, and molecular features in 16 novel patients. Immunol Rev. 2005 Feb;203:110-26.|[4]Sarita A Y Hartgring, et al. Elevated expression of interleukin-7 receptor in inflamed joints mediates interleukin-7-induced immune activation in rheumatoid arthritis. Arthritis Rheum. 2009 Sep;60 (9) :2595-605.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Guanine Nucleotide-Binding Protein G(T) Subunit Alpha-1 (GNAT1) ELISA Kit
MBS9941746 Inquire

Duck Guanine Nucleotide-Binding Protein G(T) Subunit Alpha-1 (GNAT1) ELISA Kit

Sign In for Pricing
View Details
NBPF5 Antibody (C-term)
orb1937534-01 50 µL

NBPF5 Antibody (C-term)

Sign In for Pricing
View Details
NBPF5 Antibody (C-term)
orb1937534-02 100 µL

NBPF5 Antibody (C-term)

Sign In for Pricing
View Details
Mouse Tmem215 (NM_177175) AAV Particle
MR213372A1V 250 µL

Mouse Tmem215 (NM_177175) AAV Particle

Sign In for Pricing
View Details
TUBGCP5 Antibody
DF4076-01 100 µL

TUBGCP5 Antibody

Sign In for Pricing
View Details
TUBGCP5 Antibody
DF4076-02 200 µL

TUBGCP5 Antibody

Sign In for Pricing
View Details