Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AXL, Mouse (HEK293, His)

AXL Protein, Mouse (HEK293, His), a recombinant mouse AXL produced in HEK293 cells, has a His tag. AXL is a member of the TAM family with the high-affinity ligand growth arrest-specific protein 6 (GAS6) . Anti-cancer activity[1].

Product Specifications

Product Name Alternative

AXL Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/axl-protein-mouse-hek293-his.html

Purity

95.0

Smiles

AHKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPHHHHHH

Molecular Formula

26362 (Gene_ID) Q00993 (A19-P443) (Accession)

Molecular Weight

60-80 kDa

References & Citations

[1]Chenjing Zhu, et al. AXL receptor tyrosine kinase as a promising anti-cancer approach: functions, molecular mechanisms and clinical applications. Mol Cancer. 2019 Nov 4;18 (1) :153.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CEACAM5/CD66e Antibody (CEA31) [Biotin]
NBP2-34594B 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (CEA31) [Biotin]

Ask
View Details
Anti-POLR2H antibody
PAab06624 100 µg

Anti-POLR2H antibody

Ask
View Details
Human Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C (ANKRD52) ELISA Kit
MBS7222623-01 48 Well

Human Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C (ANKRD52) ELISA Kit

Ask
View Details
Human Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C (ANKRD52) ELISA Kit
MBS7222623-02 96 Well

Human Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C (ANKRD52) ELISA Kit

Ask
View Details
Human Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C (ANKRD52) ELISA Kit
MBS7222623-03 5x 96 Well

Human Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C (ANKRD52) ELISA Kit

Ask
View Details
Human Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C (ANKRD52) ELISA Kit
MBS7222623-04 10x 96 Well

Human Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit C (ANKRD52) ELISA Kit

Ask
View Details