Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon lambda receptor 1 (IFNLR1), partial

Product Specifications

Product Name Alternative

Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)

Abbreviation

Recombinant Human IFNLR1 protein, partial

Gene Name

IFNLR1

UniProt

Q8IU57

Expression Region

21-228aa

Organism

Homo sapiens (Human)

Target Sequence

RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR) -induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.6 kDa

References & Citations

"IFN-lambdas mediate antiviral protection through a distinct class II cytokine receptor complex." Kotenko S.V., Gallagher G., Baurin V.V., Lewis-Antes A., Shen M., Shah N.K., Langer J.A., Sheikh F., Dickensheets H., Donnelly R.P. Nat. Immunol. 4:69-77 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Anti-streptolysin O IgG antibody ELISA Kit
AE62725RA-01 48 Tests

Rat Anti-streptolysin O IgG antibody ELISA Kit

Ask
View Details
Rat Anti-streptolysin O IgG antibody ELISA Kit
AE62725RA-02 96 Tests

Rat Anti-streptolysin O IgG antibody ELISA Kit

Ask
View Details
Anti-Acetyl-Histone H3 (Lys14) H3F3A Rabbit Monoclonal Antibody
B2020199 100 µg

Anti-Acetyl-Histone H3 (Lys14) H3F3A Rabbit Monoclonal Antibody

Ask
View Details
KYNU Knockout huh-7 Polyclonal Cells
ARG28509 1 Million

KYNU Knockout huh-7 Polyclonal Cells

Ask
View Details
MAGEB18 Human Gene Knockout Kit (CRISPR)
KN406329 1 Kit

MAGEB18 Human Gene Knockout Kit (CRISPR)

Ask
View Details
USP14 Protein Lysate (Mouse) with C-HA Tag
49283034 100 µg

USP14 Protein Lysate (Mouse) with C-HA Tag

Ask
View Details