Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Rat

PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-bb-protein-rat.html

Purity

97.00

Smiles

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

24628 (Gene_ID) Q05028 (S74-T182) (Accession)

Molecular Weight

Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Badwelan M, et al. The Efficacy of Recombinant Platelet-Derived Growth Factor on Beta-Tricalcium Phosphate to Regenerate Femoral Critical Sized Segmental Defects: Longitudinal In Vivo Micro-CT Study in a Rat Model. J Invest Surg. 2018 Nov 15:1-13.|[2]Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC1 Antibody
KC-26953-01 50 μL

SIGLEC1 Antibody

Sign In for Pricing
View Details
SIGLEC1 Antibody
KC-26953-02 100 µL

SIGLEC1 Antibody

Sign In for Pricing
View Details
SIGLEC1 Antibody
KC-26953-03 1 mL

SIGLEC1 Antibody

Sign In for Pricing
View Details
CD45RO (UCHL1 + T200/797), CF647 conjugate, 0.1mg/mL
BNC471209-100 1x 100 µL

CD45RO (UCHL1 + T200/797), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spinetoram L
TRC-S683613-5MG 5 mg

Spinetoram L

Sign In for Pricing
View Details
CHRDL1 Antibody (Biotin)
KB-8099-01 50 μL

CHRDL1 Antibody (Biotin)

Sign In for Pricing
View Details