PDGF-BB, Rat
PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.
Product Specifications
Product Name Alternative
PDGF-BB Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-bb-protein-rat.html
Purity
97.00
Smiles
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT
Molecular Formula
24628 (Gene_ID) Q05028 (S74-T182) (Accession)
Molecular Weight
Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Badwelan M, et al. The Efficacy of Recombinant Platelet-Derived Growth Factor on Beta-Tricalcium Phosphate to Regenerate Femoral Critical Sized Segmental Defects: Longitudinal In Vivo Micro-CT Study in a Rat Model. J Invest Surg. 2018 Nov 15:1-13.|[2]Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
N2050-11V 100 µg
Nerve Growth Factor Receptor, p75 (NGFR, NGF Receptor, CD271, Gp80 LNGFR, Low Affinity Nerve Growth Factor Receptor, Low Affinity Neurotrophin Receptor p75 NTR, p75 ICD, p75 Neurotrophin, p75 NTR, Tumor Necrosis Factor Receptor Superfamily Member 16, TNFR Superfamily Member 16, TNFRSF16) discontinued, see 146069
Sign In for Pricing
View Details 
OR1063330-01 50 mg
7- ((4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) benzyl) oxy) -2H-chromen-2-one
Sign In for Pricing
View Details OR1063330-02 100 mg
7- ((4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) benzyl) oxy) -2H-chromen-2-one
Sign In for Pricing
View Details OR1063330-03 250 mg
7- ((4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) benzyl) oxy) -2H-chromen-2-one
Sign In for Pricing
View Details