Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vitronectin, Human (HEK293, His)

Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (HEK293, His) is the recombinant human-derived Vitronectin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Vitronectin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vitronectin-protein-human-hek-293-his.html

Purity

98.0

Smiles

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Molecular Formula

7448 (Gene_ID) P04004/AAH05046.1 (D20-L478) (Accession)

Molecular Weight

Approximately 65-77 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HESX1 Recombinant Protein (Human)
RP014590 100 µg

HESX1 Recombinant Protein (Human)

Sign In for Pricing
View Details
AF647 Rat IgM, κ Isotype Control
RD22358F-01 20 Tests

AF647 Rat IgM, κ Isotype Control

Sign In for Pricing
View Details
AF647 Rat IgM, κ Isotype Control
RD22358F-02 100 Tests

AF647 Rat IgM, κ Isotype Control

Sign In for Pricing
View Details
AF647 Rat IgM, κ Isotype Control
RD22358F-03 2x 100 Tests

AF647 Rat IgM, κ Isotype Control

Sign In for Pricing
View Details
Sieve Brass 200mm x 8mm - EACH
SIE2158 1 Each

Sieve Brass 200mm x 8mm - EACH

Sign In for Pricing
View Details
Angiotensin II, Competitive BioAssayTM ELISA Kit (Bovine) discontinued
350962 96 Tests

Angiotensin II, Competitive BioAssayTM ELISA Kit (Bovine) discontinued

Sign In for Pricing
View Details