Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Mouse (HEK293, His)

Siglec-15 Protein, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis, inhibiting antigen-specific T cell responses in vitro and in vivo. Siglec-15 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Siglec-15 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

RRDASGDLLNTEAHSAPAQRWSMQVPAEVNAEAGDAAVLPCTFTHPHRHYDGPLTAIWRSGEPYAGPQVFRCTAAPGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADSGRYFCRVEFTGDAHDRYESRHGVRLRVTAAAPRIVNISVLPGPAHAFRALCTAEGEPPPALAWSGPAPGNSSAALQGQGHGYQVTAELPALTRDGRYTCTAANSLGRAEASVYLFRFHGAPGTST

Molecular Formula

620235 (Gene_ID) A7E1W8 (R24-T262) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGLV1-51 Antibody
MBS7127990-01 0.05 mL

IGLV1-51 Antibody

Sign In for Pricing
View Details
IGLV1-51 Antibody
MBS7127990-02 0.1 mL

IGLV1-51 Antibody

Sign In for Pricing
View Details
IGLV1-51 Antibody
MBS7127990-03 5x 0.1 mL

IGLV1-51 Antibody

Sign In for Pricing
View Details
PSMB4 3'UTR Luciferase Stable Cell Line
TU019042 1.0 mL

PSMB4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-CARD12/NLRC4 Antibody Picoband® (PE Conjugate)
PB9673-PE 100 µg/Vial

Anti-CARD12/NLRC4 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
Rabbit Polyclonal Contactin-5 Antibody [PerCP]
NBP2-97316PCP 0.1 mL

Rabbit Polyclonal Contactin-5 Antibody [PerCP]

Sign In for Pricing
View Details