Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active)

GETTTGAPRALSTLGFPSPFTTPGVPSTLTTPGLTTPGTTKTLDLRSRAQALMRDFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHSQTSLDRLRDGLVGAQFWSASVSCQTQDQTAVRLALEQIDLIRRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCNTPWAESSTKFTHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLMRRVLEVSRAPVIFSHSAARAVCDNSLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGAGRFPQGLEDVSTYPVLIEELLSRSWSEKELQGVLRGNLLRVFRQAEKVREESRAQSPMEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKWPTNRVPWRS

Lacks dipeptidase activity and is unable to hydrolyze cystinyl-bis-glycine, leukotriene D4 and the beta-lactam antibiotic imipenem. The absence of activity may be due to the inability of asparagine (instead of aspartate found in DPEP1/2) at position 359 to function as the acid/base catalyst and activate the nucleophilic water/hydroxide. A tyrosine (instead of histidine) at position 269 reduces affinity for the beta zinc and may cause substrate steric hindrance.

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU) . The EC50 is 7.817-8.936 ng/mL.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.