Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active)

Product Specifications

Abbreviation

Recombinant Cynomolgus monkey DPEP3 protein (Active)

Gene Name

DPEP3

UniProt

Q4R7M2

Expression Region

36-463aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

GETTTGAPRALSTLGFPSPFTTPGVPSTLTTPGLTTPGTTKTLDLRSRAQALMRDFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHSQTSLDRLRDGLVGAQFWSASVSCQTQDQTAVRLALEQIDLIRRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCNTPWAESSTKFTHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLMRRVLEVSRAPVIFSHSAARAVCDNSLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGAGRFPQGLEDVSTYPVLIEELLSRSWSEKELQGVLRGNLLRVFRQAEKVREESRAQSPMEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKWPTNRVPWRS

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Lacks dipeptidase activity and is unable to hydrolyze cystinyl-bis-glycine, leukotriene D4 and the beta-lactam antibiotic imipenem. The absence of activity may be due to the inability of asparagine (instead of aspartate found in DPEP1/2) at position 359 to function as the acid/base catalyst and activate the nucleophilic water/hydroxide. A tyrosine (instead of histidine) at position 269 reduces affinity for the beta zinc and may cause substrate steric hindrance.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU) . The EC50 is 7.817-8.936 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-EL-M2445-01 24 Tests

Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-EL-M2445-02 48 Tests

Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-EL-M2445-03 96 Tests

Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Phytic Acid Dodecasodium Salt Hydrate
TRC-P398713-5G 5 g

Phytic Acid Dodecasodium Salt Hydrate

Sign In for Pricing
View Details
ZIM3 antibody
FNab09638 100 µg

ZIM3 antibody

Sign In for Pricing
View Details
N-(3-Phenylpropionyl)glycine
TRC-P336210-1G 1 g

N-(3-Phenylpropionyl)glycine

Sign In for Pricing
View Details