PD-1, Rat (HEK293, His)
Programmed cell death protein 1 (Pdcd1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. Pdcd1plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but Pdcd1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-1 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
PD-1 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pd-1-protein-rat-hek293-his.html
Purity
97.80
Smiles
LEVLNKPWRPLTFSPTWLTVSEGANATFTCSFSNWSEDLKLNWYRLSPSNQTEKQAAFCNGYSQPVRDARFQIVQLPNGHDFHMNILDARRNDSGIYLCGAISLPPKAQIKESPGAELVVTERILETPTRYPRPSPKPEGQFQ
Molecular Formula
301626 (Gene_ID) D3ZIN8/NP_001100397.1 (L25-Q167) (Accession)
Molecular Weight
Approximately 30-40 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
