Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARC/CCL17, Rat (His)

CCL17 protein is a chemokine with selective chemotactic activity towards Th2 cells and plays a crucial role in various inflammatory and immune processes. It coordinates immune responses by binding to CCR4 on the surface of T cells. TARC/CCL17 Protein, Rat (His) is the recombinant rat-derived TARC/CCL17 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TARC/CCL17 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl17-protein-rat.html

Purity

98.0

Smiles

ARATNVGRECCLDYFKGAIPIRKLVTWFRTSVECPKDAIVFETVQGRLICTDPKDKHVKKAIRHLKNQRL

Molecular Formula

117518 (Gene_ID) Q9ERE0 (A24-L93) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GPR164 (Olfactory Receptor 51E1, D-GPCR, G-protein Coupled Receptor 164, Olfactory Receptor 52A3, Prostate-overexpressed G-Protein-coupled Receptor, Prostate-specific G-Protein-coupled Receptor 2, OR51E1, OR51E1P, OR52A3P, POGR, PSGR2) discontinued
G8603-29 50 µL

GPR164 (Olfactory Receptor 51E1, D-GPCR, G-protein Coupled Receptor 164, Olfactory Receptor 52A3, Prostate-overexpressed G-Protein-coupled Receptor, Prostate-specific G-Protein-coupled Receptor 2, OR51E1, OR51E1P, OR52A3P, POGR, PSGR2) discontinued

Ask
View Details
Anti-FLJ23834  (1B11)
YF-MA20046 100 ug

Anti-FLJ23834 (1B11)

Ask
View Details