TARC/CCL17, Rat (His)
CCL17 protein is a chemokine with selective chemotactic activity towards Th2 cells and plays a crucial role in various inflammatory and immune processes. It coordinates immune responses by binding to CCR4 on the surface of T cells. TARC/CCL17 Protein, Rat (His) is the recombinant rat-derived TARC/CCL17 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
TARC/CCL17 Protein, Rat (His), Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ccl17-protein-rat.html
Purity
98.0
Smiles
ARATNVGRECCLDYFKGAIPIRKLVTWFRTSVECPKDAIVFETVQGRLICTDPKDKHVKKAIRHLKNQRL
Molecular Formula
117518 (Gene_ID) Q9ERE0 (A24-L93) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
KLF4, NT (KLF4, EZF, GKLF, Krueppel-like factor 4, Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor) (PE)
KLF4, NT (KLF4, EZF, GKLF, Krueppel-like factor 4, Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor) (PE)
![NAB1 Mouse Monoclonal Antibody [Clone ID: LBI4G10]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)