Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CMRF35-like molecule 6 (Cd300c), partial

Product Specifications

Product Name Alternative

(CLM-6) (CD300 antigen-like family member C) (CD antigen CD300c)

Abbreviation

Recombinant Mouse Cd300c protein, partial

Gene Name

Cd300c

UniProt

A2A7V7

Expression Region

22-188aa

Organism

Mus musculus (Mouse)

Target Sequence

HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPH

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.8 kDa

References & Citations

"CMRF-35-like molecule-1, a novel mouse myeloid receptor, can inhibit osteoclast formation." Chung D.-H., Humphrey M.B., Nakamura M.C., Ginzinger D.G., Seaman W.E., Daws M.R. J. Immunol. 171:6541-6548 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Neuropeptide S (NPS)
TRV-0017235-01 24 Tests

ELISA Kit for Neuropeptide S (NPS)

Sign In for Pricing
View Details
ELISA Kit for Neuropeptide S (NPS)
TRV-0017235-02 48 Tests

ELISA Kit for Neuropeptide S (NPS)

Sign In for Pricing
View Details
ELISA Kit for Neuropeptide S (NPS)
TRV-0017235-03 96 Tests

ELISA Kit for Neuropeptide S (NPS)

Sign In for Pricing
View Details
ELISA Kit for Neuropeptide S (NPS)
TRV-0017235-04 5x 96 Tests

ELISA Kit for Neuropeptide S (NPS)

Sign In for Pricing
View Details
ELISA Kit for Neuropeptide S (NPS)
TRV-0017235-05 10x 96 Tests

ELISA Kit for Neuropeptide S (NPS)

Sign In for Pricing
View Details
Recombinant Escherichia coli yohD Protein (aa 1-192)
VAng-Lsx02968-inquire Inquire

Recombinant Escherichia coli yohD Protein (aa 1-192)

Sign In for Pricing
View Details