Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin beta E chain (INHBE)

Product Specifications

Product Name Alternative

(Activin beta-E chain)

Abbreviation

Recombinant Human INHBE protein

Gene Name

INHBE

UniProt

P58166

Expression Region

237-350aa

Organism

Homo sapiens (Human)

Target Sequence

TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Substrate recognition component of a DCX (DDB1-CUL4-X-box) E3 protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as MEIS2. Normal degradation of key regulatory proteins is required for normal limb outgrowth and expression of the fibroblast growth factor FGF8. May play a role in memory and learning by regulating the assembly and neuronal surface expression of large-conductance calcium-activated potassium channels in brain regions involved in memory and learning via its interaction with KCNT1. Binding of pomalidomide and other thalidomide-related drugs changes the substrate specificity of the human protein, leading to decreased degradation of MEIS2 and other target proteins and increased degradation of MYC, IRF4, IKZF1 and IKZF3.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.4 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45 (2004) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdyl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4922908 1.0 µg DNA

Cdyl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
HLA-A*0201 Vaccinia Virus Complex, Human (Biotinylated, LLSYYVVYV, HEK293, His-Avi)
HY-P705342-01 25 µg

HLA-A*0201 Vaccinia Virus Complex, Human (Biotinylated, LLSYYVVYV, HEK293, His-Avi)

Sign In for Pricing
View Details
HLA-A*0201 Vaccinia Virus Complex, Human (Biotinylated, LLSYYVVYV, HEK293, His-Avi)
HY-P705342-02 200 µg

HLA-A*0201 Vaccinia Virus Complex, Human (Biotinylated, LLSYYVVYV, HEK293, His-Avi)

Sign In for Pricing
View Details
Human NPS (Neuropeptide S) ELISA Kit
EKF60570 96 Tests

Human NPS (Neuropeptide S) ELISA Kit

Sign In for Pricing
View Details
GRASPOS Protein Vector (Human) (pPM-C-His)
PV081636 500 ng

GRASPOS Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Agrobacterium tumefaciens L-rhamnose mutarotase (rhaM)
MBS1165651-01 0.02 mg (E-Coli)

Recombinant Agrobacterium tumefaciens L-rhamnose mutarotase (rhaM)

Sign In for Pricing
View Details