Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d2 sgRNA CRISPR Lentivector set (Mouse)
K4882001 3x 1.0 µg

Tbc1d2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse MMP-9 (Matrix Metalloproteinase 9) ELISA Kit
EKE62983 96 Tests

Mouse MMP-9 (Matrix Metalloproteinase 9) ELISA Kit

Sign In for Pricing
View Details
Kcnn1 Rat shRNA Plasmid (Locus ID 54261)
TL710318 1 Kit

Kcnn1 Rat shRNA Plasmid (Locus ID 54261)

Sign In for Pricing
View Details
Tuberin (TSC2) (NM_000548) Human Mutant ORF Clone
RC402303 10 µg

Tuberin (TSC2) (NM_000548) Human Mutant ORF Clone

Sign In for Pricing
View Details
EGFR-IN-54
MBS5805144 Inquire

EGFR-IN-54

Sign In for Pricing
View Details
CARKL (SHPK) Mouse Monoclonal Antibody [Clone ID: LBI4E9]
AMM11586V 100 µL

CARKL (SHPK) Mouse Monoclonal Antibody [Clone ID: LBI4E9]

Sign In for Pricing
View Details