Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANAPC13 (1-74, T7 tag) Human Protein
AR50234PU-S 50 µg

ANAPC13 (1-74, T7 tag) Human Protein

Sign In for Pricing
View Details
Microtubule-associated protein RP/EB family member 3 (MAPRE3) Human ELISA Kit
E9993 96 Tests

Microtubule-associated protein RP/EB family member 3 (MAPRE3) Human ELISA Kit

Sign In for Pricing
View Details
Anti-C3AR1/C3Ar Antibody
B2022528 100 µL

Anti-C3AR1/C3Ar Antibody

Sign In for Pricing
View Details
FSTL3 Protein (C-His, Mouse)
P524803 100 µg

FSTL3 Protein (C-His, Mouse)

Sign In for Pricing
View Details
Tebideutorexant
HY-147403S-01 1 mg

Tebideutorexant

Sign In for Pricing
View Details
Tebideutorexant
HY-147403S-02 5 mg

Tebideutorexant

Sign In for Pricing
View Details