Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse RPS6KA3 Protein, His (Fc)-Avi-tagged
RPS6KA3-7792M 50 µg

Recombinant Mouse RPS6KA3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rabbit Anti-Mouse A Disintegrin and Metalloprotease 8 (ADAM8) Polyclonal Antibody
VD2N47 1 Each

Rabbit Anti-Mouse A Disintegrin and Metalloprotease 8 (ADAM8) Polyclonal Antibody

Sign In for Pricing
View Details
TNF Receptor I Recombinant Rabbit mAb
E43S48586 100 µL

TNF Receptor I Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rat Angiotensin 1-7 (Ang1-7) ELISA Kit
EKU10060 96 Tests

Rat Angiotensin 1-7 (Ang1-7) ELISA Kit

Sign In for Pricing
View Details
ANKRD6 Polyclonal Antibody
ANT-10212-100ug 100 µg

ANKRD6 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bovine Histone H2B type 1-N (HIST1H2BN)
MBS1331535-01 0.02 mg (E-Coli)

Recombinant Bovine Histone H2B type 1-N (HIST1H2BN)

Sign In for Pricing
View Details