Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUB domain-containing protein 2 (CDCP2) Human ELISA Kit
C6543 96 Tests

CUB domain-containing protein 2 (CDCP2) Human ELISA Kit

Sign In for Pricing
View Details
SLC13A5 (NM_177550) Human Tagged ORF Clone Lentiviral Particle
RC211155L3V 200 µL

SLC13A5 (NM_177550) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MORC1, CT (MORC1, MORC, MORC family CW-type zinc finger protein 1, Cancer/testis antigen 33) (MaxLight 750)
MBS6321700-01 0.1 mL

MORC1, CT (MORC1, MORC, MORC family CW-type zinc finger protein 1, Cancer/testis antigen 33) (MaxLight 750)

Sign In for Pricing
View Details
MORC1, CT (MORC1, MORC, MORC family CW-type zinc finger protein 1, Cancer/testis antigen 33) (MaxLight 750)
MBS6321700-02 5x 0.1 mL

MORC1, CT (MORC1, MORC, MORC family CW-type zinc finger protein 1, Cancer/testis antigen 33) (MaxLight 750)

Sign In for Pricing
View Details
IBV (strain KB8523) Replicase polyprotein 1ab (His)
MF-0129565-01 5 µg

IBV (strain KB8523) Replicase polyprotein 1ab (His)

Sign In for Pricing
View Details
IBV (strain KB8523) Replicase polyprotein 1ab (His)
MF-0129565-02 10 µg

IBV (strain KB8523) Replicase polyprotein 1ab (His)

Sign In for Pricing
View Details