Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Murine Neuropoietin
P6180-500μg 500 µg

Recombinant Murine Neuropoietin

Sign In for Pricing
View Details
Hemoglobin subunit epsilon (HBE1) Human shRNA Plasmid Kit (Locus ID 3046)
TR312510 1 Kit

Hemoglobin subunit epsilon (HBE1) Human shRNA Plasmid Kit (Locus ID 3046)

Sign In for Pricing
View Details
TACI/TNFRSF13B/CVID Blocking Peptide
NBP1-76779PEP 0.05 mg

TACI/TNFRSF13B/CVID Blocking Peptide

Sign In for Pricing
View Details
Yttrium nitrate hexahydrate
RM2520-100G 1 unit

Yttrium nitrate hexahydrate

Sign In for Pricing
View Details
Glrx sgRNA CRISPR Lentivector set (Mouse)
K3706801 3x 1.0 µg

Glrx sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Interleukin 11 Receptor Alpha (IL11Ra)
MBS2010639-01 0.01 mg

Recombinant Interleukin 11 Receptor Alpha (IL11Ra)

Sign In for Pricing
View Details