Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Heptadecylresorcinol
HY-N2673-01 5 mg

5-Heptadecylresorcinol

Sign In for Pricing
View Details
5-Heptadecylresorcinol
HY-N2673-02 10 mg

5-Heptadecylresorcinol

Sign In for Pricing
View Details
Sectm1b Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV650025 1.0 µg DNA

Sectm1b Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
S100A7 (PSOR1, S100A7C, Protein S100-A7, Psoriasin, S100 Calcium-binding Protein A7) (FITC)
MBS6393181-01 0.1 mL

S100A7 (PSOR1, S100A7C, Protein S100-A7, Psoriasin, S100 Calcium-binding Protein A7) (FITC)

Sign In for Pricing
View Details
S100A7 (PSOR1, S100A7C, Protein S100-A7, Psoriasin, S100 Calcium-binding Protein A7) (FITC)
MBS6393181-02 5x 0.1 mL

S100A7 (PSOR1, S100A7C, Protein S100-A7, Psoriasin, S100 Calcium-binding Protein A7) (FITC)

Sign In for Pricing
View Details
3-[1-(3-Bromophenyl)-1-hydroxy-n-butyl]benzoic Acid t-Butyl Ester-D9
TRC-B699932-25MG 25 mg

3-[1-(3-Bromophenyl)-1-hydroxy-n-butyl]benzoic Acid t-Butyl Ester-D9

Sign In for Pricing
View Details