Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sec13 ORF Vector (Mouse) (pORF)
43285014 1.0 µg DNA

Sec13 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal Filaggrin Antibody (rFLG/1945) [DyLight 350]
NBP3-14280UV 0.1 mL

Mouse Monoclonal Filaggrin Antibody (rFLG/1945) [DyLight 350]

Sign In for Pricing
View Details
Anti-PKLR  (4C9)
YF-MA14749 100 ug

Anti-PKLR (4C9)

Sign In for Pricing
View Details
ZNF643, ID (ZNF643, Zinc finger protein 643) (Biotin) discontinued
044315-Biotin 200 µL

ZNF643, ID (ZNF643, Zinc finger protein 643) (Biotin) discontinued

Sign In for Pricing
View Details
GOLGA6 sgRNA CRISPR Lentivector set (Human)
K0881301 3x 1.0 µg

GOLGA6 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Gm1604 siRNA (m)
sc-145497 10 µM

Gm1604 siRNA (m)

Sign In for Pricing
View Details