Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plcl2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6153408 1.0 µg DNA

Plcl2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Specc1l (NM_001145826) Mouse Tagged ORF Clone
MG222318 10 µg

Specc1l (NM_001145826) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
A 804598
440616-01 5 mg

A 804598

Sign In for Pricing
View Details
A 804598
440616-02 10 mg

A 804598

Sign In for Pricing
View Details
Human LIN28B knockdown cell line
ABC-KD8475 1 Vial

Human LIN28B knockdown cell line

Sign In for Pricing
View Details
Gasoline Range Organics - 1ML
GRO-1000 1 mL

Gasoline Range Organics - 1ML

Sign In for Pricing
View Details