Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAE30P Protein Lysate (Human) with C-Ha Tag
47997031 100 µg

TRNAE30P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Nr2c1 3'UTR GFP Stable Cell Line
TU164293 1.0 mL

Nr2c1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-Campylobacter jejuni flaB Polyclonal Antibody
MBS7194185 Inquire

Rabbit anti-Campylobacter jejuni flaB Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Shigella Boydii nudK Protein (aa 1-191)
VAng-Lsx08739-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii nudK Protein (aa 1-191)

Sign In for Pricing
View Details
Human DICER1 knockout cell line
ABC-KH4193 1 Vial

Human DICER1 knockout cell line

Sign In for Pricing
View Details
NFκB-p65 (Phospho-Ser276) Antibody
RDSA62015 100 µL

NFκB-p65 (Phospho-Ser276) Antibody

Sign In for Pricing
View Details