Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse CD102-FITC
31-2273-0.1 0.1 mg

Rat Anti-Mouse CD102-FITC

Sign In for Pricing
View Details
CCDC83 sgRNA CRISPR Lentivector (Human) (Target 1)
K0380302 1.0 µg DNA

CCDC83 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TMEM24 (C2CD2L) Human Recombinant Protein
TP726079 50 µg

TMEM24 (C2CD2L) Human Recombinant Protein

Sign In for Pricing
View Details
TAT Protein Vector (Mouse) (pPB-C-His)
PV236534 500 ng

TAT Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
GRIP1 Recombinant Protein Antigen
NBP1-86252PEP 0.1 mL

GRIP1 Recombinant Protein Antigen

Sign In for Pricing
View Details
TSN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV625259 1.0 µg DNA

TSN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details