Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RING Finger Protein 125 (RNF125, E3 Ubiquitin-protein Ligase RNF125, T-cell RING Activation Protein 1, TRAC1, TRAC-1) (APC)
132644-APC 100 µL

RING Finger Protein 125 (RNF125, E3 Ubiquitin-protein Ligase RNF125, T-cell RING Activation Protein 1, TRAC1, TRAC-1) (APC)

Sign In for Pricing
View Details
Human V-set domain-containing T-cell activation inhibitor 1 (VTCN1) ELISA Kit
RK02512 96 Tests

Human V-set domain-containing T-cell activation inhibitor 1 (VTCN1) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-4 (IL-4) Antibody (Biotin Conjugate)
32184-05121 150 µg

Human Interleukin-4 (IL-4) Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
MYT1L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1384406 1.0 µg DNA

MYT1L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-h ST2 10207 SPTN-5
MBS5680570-01 1 mg

Anti-h ST2 10207 SPTN-5

Sign In for Pricing
View Details
Anti-h ST2 10207 SPTN-5
MBS5680570-02 5x 1 mg

Anti-h ST2 10207 SPTN-5

Sign In for Pricing
View Details