Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiMethyl-Histone H3 (K4) Antibody, mAb, Rabbit
A02530-100 100 µL

DiMethyl-Histone H3 (K4) Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Prokaryotic Human Transmembrane Channel Like Protein 4
RPU60101-01 50 µg

Prokaryotic Human Transmembrane Channel Like Protein 4

Sign In for Pricing
View Details
Prokaryotic Human Transmembrane Channel Like Protein 4
RPU60101-02 100 µg

Prokaryotic Human Transmembrane Channel Like Protein 4

Sign In for Pricing
View Details
Prokaryotic Human Transmembrane Channel Like Protein 4
RPU60101-03 1 mg

Prokaryotic Human Transmembrane Channel Like Protein 4

Sign In for Pricing
View Details
Mouse Monoclonal Serine racemase Antibody (OTI2E3) [Alexa Fluor 647]
NBP2-74083AF647 0.1 mL

Mouse Monoclonal Serine racemase Antibody (OTI2E3) [Alexa Fluor 647]

Sign In for Pricing
View Details
Mouse CLIP2 siRNA
abx912082-01 15 nmol

Mouse CLIP2 siRNA

Sign In for Pricing
View Details