Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

F8A3 siRNA (Human)
CRJ8352-01 15 nmol

F8A3 siRNA (Human)

Sign In for Pricing
View Details
F8A3 siRNA (Human)
CRJ8352-02 30 nmol

F8A3 siRNA (Human)

Sign In for Pricing
View Details
Mir500 Mouse qPCR Primer Pair (MI0004702)
MP300366 200 Reactions

Mir500 Mouse qPCR Primer Pair (MI0004702)

Sign In for Pricing
View Details
Pig Aquaporin 5 (AQP5) ELISA Kit
abx513411 96 Tests

Pig Aquaporin 5 (AQP5) ELISA Kit

Sign In for Pricing
View Details
A 80915A
HY-118367 1 Each

A 80915A

Sign In for Pricing
View Details
Rabbit Polyclonal Carboxyl Ester Lipase/CEL Antibody [HRP]
NBP2-98314H 0.1 mL

Rabbit Polyclonal Carboxyl Ester Lipase/CEL Antibody [HRP]

Sign In for Pricing
View Details