Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Human (177a.a, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia and stimulates cell proliferation and differentiation. TNF-alpha/TNFSF2 Protein, Human (177a.a, His) is the recombinant human-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Human (177a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-human-177aa-his.html

Purity

95.0

Smiles

GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Molecular Formula

7124 (Gene_ID) P01375 (G57-L233) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-500 1x 500 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-500 1x 500 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-100 1x 100 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details