Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cardiotrophin-1/CTF1, Rat

Cardiotropin-1/CTF1 protein plays a key role in inducing cardiomyocyte hypertrophy in vitro. Its effects on myocardial development and enlargement are mediated through binding and activation of ILST/gp130 receptors. Cardiotrophin-1/CTF1 Protein, Rat is the recombinant rat-derived Cardiotrophin-1/CTF1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Cardiotrophin-1/CTF1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cardiotrophin-1-protein-rat.html

Purity

98.00

Smiles

MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPGGVA

Molecular Formula

29201 (Gene_ID) Q63086 (M1-A203) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis C Virus Core Antigen, aa80-120 (HCV) (FITC)
MBS6125383-01 0.1 mL

Hepatitis C Virus Core Antigen, aa80-120 (HCV) (FITC)

Sign In for Pricing
View Details
Hepatitis C Virus Core Antigen, aa80-120 (HCV) (FITC)
MBS6125383-02 5x 0.1 mL

Hepatitis C Virus Core Antigen, aa80-120 (HCV) (FITC)

Sign In for Pricing
View Details
pSV40-Atp6v1c1-m (90-1149bp) Plasmid
PVT11453 2 µg

pSV40-Atp6v1c1-m (90-1149bp) Plasmid

Sign In for Pricing
View Details
Pentraxin 3 (PTX3) (NM_002852) Human Recombinant Protein
E45H38297M5 20 µg

Pentraxin 3 (PTX3) (NM_002852) Human Recombinant Protein

Sign In for Pricing
View Details
(±)-5-iPF2alpha-VI-d11
TRC-I874712-25MG 25 mg

(±)-5-iPF2alpha-VI-d11

Sign In for Pricing
View Details
Ndufs5 Rat siRNA Oligo Duplex (Locus ID 362588)
SR510189 1 Kit

Ndufs5 Rat siRNA Oligo Duplex (Locus ID 362588)

Sign In for Pricing
View Details