Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIF, Human (His)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. Animal-Free MIF Protein, Human (His) is the recombinant human-derived animal-FreeMIF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mif-protein-human-his.html

Purity

95.0

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zrsr2 Mouse siRNA Oligo Duplex (Locus ID 22184)
SR417036 1 Kit

Zrsr2 Mouse siRNA Oligo Duplex (Locus ID 22184)

Sign In for Pricing
View Details
Anti-B7-H2 (Rabbit, Monoclonal, Rabbit IgG)
A100074 100 µL

Anti-B7-H2 (Rabbit, Monoclonal, Rabbit IgG)

Sign In for Pricing
View Details
Lman1 siRNA Oligos set (Rat)
26893176 3x 5 nmol

Lman1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Tuba3a shRNA (UAS) - Lentiviral mouse Tuba3a shRNA (UAS, RFP) (100)
GTR15128400 1 Vial

Lentiviral mouse Tuba3a shRNA (UAS) - Lentiviral mouse Tuba3a shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Sheep Anoctamin-4 (ANO4) ELISA Kit
MBS7230067-01 48 Well

Sheep Anoctamin-4 (ANO4) ELISA Kit

Sign In for Pricing
View Details
Sheep Anoctamin-4 (ANO4) ELISA Kit
MBS7230067-02 96 Well

Sheep Anoctamin-4 (ANO4) ELISA Kit

Sign In for Pricing
View Details