Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A3, Mouse (His)

S100A3 Protein, acting as a homodimer with disulfide linkages, exhibits strong binding affinity for beta-galactoside and lactose.Notably, it potently induces T-cell apoptosis, as demonstrated in various studies, and displays hemagglutinating activity towards chicken erythrocytes.These properties underscore S100A3's multifaceted roles in cellular interactions and immune modulation.S100A3 Protein, Mouse (His) is the recombinant mouse-derived S100A3 protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A3 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a3-protein-mouse-his.html

Purity

96.00

Smiles

MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ

Molecular Formula

20197 (Gene_ID) P62818 (M1-Q101) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Potassium thiophene-2-trifluoroborate
sc-272115 1 g

Potassium thiophene-2-trifluoroborate

Ask
View Details
1700031F05Rik Mouse siRNA Oligo Duplex (Locus ID 73300)
SR404789 1 Kit

1700031F05Rik Mouse siRNA Oligo Duplex (Locus ID 73300)

Ask
View Details
Lentiviral human PRMT5 shRNA (UAS) - Lentiviral human PRMT5 shRNA (UAS, GFP) (25)
GTR15095408 1 Vial

Lentiviral human PRMT5 shRNA (UAS) - Lentiviral human PRMT5 shRNA (UAS, GFP) (25)

Ask
View Details
Lentiviral human LMAN2 sgRNA gene knockout kit - Lentiviral human LMAN2 sgRNA gene knockout kit (plasmid)
GTR15389111 1 Vial

Lentiviral human LMAN2 sgRNA gene knockout kit - Lentiviral human LMAN2 sgRNA gene knockout kit (plasmid)

Ask
View Details
Recombinant Human Ribonuclease Pancreatic/RNASE1 Protein (C-6His)
E53A06095 50 µg

Recombinant Human Ribonuclease Pancreatic/RNASE1 Protein (C-6His)

Ask
View Details
Nuclear Receptor Subfamily 1 Group I Member 2 (NR1I2) Antibody
abx320414-01 20 µL

Nuclear Receptor Subfamily 1 Group I Member 2 (NR1I2) Antibody

Ask
View Details