Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhesus Macaque Interleukin-4 protein (IL4) (Active)

Product Specifications

Product Name Alternative

IL-4, BSF-1, Lymphocyte stimulatory factor 1

Abbreviation

Recombinant Rhesus macaque IL4 protein (Active)

Gene Name

IL4

UniProt

P51492

Expression Region

25-153aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

HNCHIALREIIETLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLEDFLERLKTIMREKYSKCSS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes (By similarity) . {ECO:0000250}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>96% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 x 106 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered 2 x PBS, pH 7.4, 5 % trehalose

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCT3 Antibody
61-581 400 µL

CCT3 Antibody

Sign In for Pricing
View Details
VSTM2L siRNA (Mouse)
MBS8209335-01 15 nmol

VSTM2L siRNA (Mouse)

Sign In for Pricing
View Details
VSTM2L siRNA (Mouse)
MBS8209335-02 30 nmol

VSTM2L siRNA (Mouse)

Sign In for Pricing
View Details
VSTM2L siRNA (Mouse)
MBS8209335-03 5x 30 nmol

VSTM2L siRNA (Mouse)

Sign In for Pricing
View Details
TIMM17A Antibody
OAAN01819-100UL 100 µL

TIMM17A Antibody

Sign In for Pricing
View Details
Goat Transmembrane 6 superfamily member 2 ELISA Kit
MBS7279936-01 48 Well

Goat Transmembrane 6 superfamily member 2 ELISA Kit

Sign In for Pricing
View Details