Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otoraplin/OTOR, Human (CHO)

Otoraplin/OTOR Protein, Human (CHO) is a protein encoded by OTOR gene, is homologous to the protein encoded by CDRAP/MIA, and may acts in cartilage development and maintenance.

Product Specifications

Product Name Alternative

Otoraplin/OTOR Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/otoraplin-otor-protein-human-cho.html

Purity

96.00

Smiles

VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Molecular Formula

56914 (Gene_ID) Q9NRC9 (V18-E128) (Accession)

Molecular Weight

Approximately 17 kDa

References & Citations

[1]Robertson NG, et al. A novel conserved cochlear gene, OTOR: identification, expression analysis, and chromosomal mapping. Genomics. 2000 Jun 15;66 (3) :242-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pBluescriptR-SPDYA Plasmid
PVTB00730 2 µg

pBluescriptR-SPDYA Plasmid

Sign In for Pricing
View Details
RGD1310352 (NM_001106999) Rat Tagged Lenti ORF Clone
RR207548L3 10 µg

RGD1310352 (NM_001106999) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HNRNPA2B1 Antibody (HRP)
orb241961-01 50 µg

HNRNPA2B1 Antibody (HRP)

Sign In for Pricing
View Details
HNRNPA2B1 Antibody (HRP)
orb241961-02 100 µg

HNRNPA2B1 Antibody (HRP)

Sign In for Pricing
View Details
APOC2, Recombinant, Human, aa23-101, His-Tag (Apolipoprotein C-II) discontinued
372299-01 10 µg

APOC2, Recombinant, Human, aa23-101, His-Tag (Apolipoprotein C-II) discontinued

Sign In for Pricing
View Details
APOC2, Recombinant, Human, aa23-101, His-Tag (Apolipoprotein C-II) discontinued
372299-02 50 µg

APOC2, Recombinant, Human, aa23-101, His-Tag (Apolipoprotein C-II) discontinued

Sign In for Pricing
View Details