Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP2, Human (HEK293, His)

SFRP2 Protein is a soluble crimson-associated protein that promotes tumor development by activating the Wnt/β-catenin signaling pathway. The methylation of SFRP2 Protein DNA is associated with tumor development. SFRP2 Protein, Human (HEK293, His) is the recombinant human-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SFRP2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp2-protein-human-hek293-c-his.html

Purity

98.0

Smiles

LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Molecular Formula

6423 (Gene_ID) Q96HF1 (L25-C295) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNLF2a (NC_007605) Virus Tagged ORF Clone
VC101181 10 µg

BNLF2a (NC_007605) Virus Tagged ORF Clone

Sign In for Pricing
View Details
ZNF193 Peptide - N-terminal region
MBS3229237-01 0.1 mg

ZNF193 Peptide - N-terminal region

Sign In for Pricing
View Details
ZNF193 Peptide - N-terminal region
MBS3229237-02 5x 0.1 mg

ZNF193 Peptide - N-terminal region

Sign In for Pricing
View Details
LPAR2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
27550066 1.0 µg DNA

LPAR2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DACT3 Protein Vector (Rat) (pPM-C-HA)
PV263060 500 ng

DACT3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal MCM2 Antibody (OTI3C12) [CoraFluor 1]
NBP2-72599CL1 0.1 mL

Mouse Monoclonal MCM2 Antibody (OTI3C12) [CoraFluor 1]

Sign In for Pricing
View Details