Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sitafloxacin Hydrate

Product Specifications

Storage Conditions

Store at -20 degree C<br>Stability: >=2 years<br>Shipping: Ice Pack

Short Name

[Sitafloxacin Hydrate]

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON1 Rabbit pAb
E2507338 100 µL

PON1 Rabbit pAb

Sign In for Pricing
View Details
AKAP10 Antibody
ABD3024 100 µg

AKAP10 Antibody

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
HMG20B Over-expression Lysate Product
GWB-6DD6D3 0.1 mg

HMG20B Over-expression Lysate Product

Sign In for Pricing
View Details
DLG5 Double Nickase Plasmid (m)
sc-427904-NIC 20 µg

DLG5 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Olr630 AAV siRNA Pooled Vector
34553166 1.0 µg

Olr630 AAV siRNA Pooled Vector

Sign In for Pricing
View Details