TSC22/TSC22D1, Human (His)
TSC22D1 Protein, a positive modulator of cell death during mammary gland involution in response to TGFB3, forms a heterodimer with TSC22D4/THG1. Its interactions with histone H1-2 and GNL3 underscore TSC22D1's versatile role in molecular processes, emphasizing its potential significance in various cellular contexts. TSC22/TSC22D1 Protein, Human (His) is the recombinant human-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
TSC22/TSC22D1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tsc22-tsc22d1-protein-human-his.html
Purity
94.30
Smiles
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Molecular Formula
8848 (Gene_ID) Q15714-2 (M1-A144) (Accession)
Molecular Weight
Approximately 19-20 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Parp12, NT (Poly [ADP-ribose] Polymerase 12, PARP-12, Zinc Finger CCCH Domain-containing Protein 1, ZC3HDC1) (MaxLight 405)](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
Parp12, NT (Poly [ADP-ribose] Polymerase 12, PARP-12, Zinc Finger CCCH Domain-containing Protein 1, ZC3HDC1) (MaxLight 405)
![Parp12, NT (Poly [ADP-ribose] Polymerase 12, PARP-12, Zinc Finger CCCH Domain-containing Protein 1, ZC3HDC1) (MaxLight 405)](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
Parp12, NT (Poly [ADP-ribose] Polymerase 12, PARP-12, Zinc Finger CCCH Domain-containing Protein 1, ZC3HDC1) (MaxLight 405)