TSC22/TSC22D1, Human (His)
TSC22D1 Protein, a positive modulator of cell death during mammary gland involution in response to TGFB3, forms a heterodimer with TSC22D4/THG1. Its interactions with histone H1-2 and GNL3 underscore TSC22D1's versatile role in molecular processes, emphasizing its potential significance in various cellular contexts. TSC22/TSC22D1 Protein, Human (His) is the recombinant human-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
TSC22/TSC22D1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tsc22-tsc22d1-protein-human-his.html
Purity
94.30
Smiles
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Molecular Formula
8848 (Gene_ID) Q15714-2 (M1-A144) (Accession)
Molecular Weight
Approximately 19-20 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
RAD26, NT (RAD26L, C9orf102, Putative DNA repair and recombination protein RAD26-like) (APC) discontinued
Recombinant Bradyrhizobium sp. Cell division topological specificity factor (minE)
Recombinant Bradyrhizobium sp. Cell division topological specificity factor (minE)
Recombinant Bradyrhizobium sp. Cell division topological specificity factor (minE)
Recombinant Bradyrhizobium sp. Cell division topological specificity factor (minE)