Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP R, Human (HEK293, His)

TSLP R Protein, a receptor for TSLP, forms a functional complex with IL7R, activating STAT3 and STAT5 for cell proliferation. It also activates JAK2, aiding in hematopoietic system development. TSLP R forms a heterodimer with CRLF2 and IL7R, highlighting its role in intricate signaling pathways crucial for cellular responses and hematopoietic development. TSLP R Protein, Human (HEK293, His) is the recombinant human-derived TSLP R protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TSLP R Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-r-protein-human-hek-293-his.html

Purity

98.0

Smiles

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Molecular Formula

64109 (Gene_ID) Q9HC73 (G25-K231) (Accession)

Molecular Weight

35-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/iFluor® 647 Anti-human CD305 Antibody *NKTA255*
130501P1-AAT 100 Tests

PE/iFluor® 647 Anti-human CD305 Antibody *NKTA255*

Sign In for Pricing
View Details
Human NRIP2 siRNA
abx926403-01 15 nmol

Human NRIP2 siRNA

Sign In for Pricing
View Details
Human NRIP2 siRNA
abx926403-02 30 nmol

Human NRIP2 siRNA

Sign In for Pricing
View Details
Hepatitis A Virus Antibody
OAMA00340-1MG 1 mg

Hepatitis A Virus Antibody

Sign In for Pricing
View Details
Nur77 (Phospho Ser351) Polyclonal Antibody
BT-AP01288-01 20 µL

Nur77 (Phospho Ser351) Polyclonal Antibody

Sign In for Pricing
View Details
Nur77 (Phospho Ser351) Polyclonal Antibody
BT-AP01288-02 50 µL

Nur77 (Phospho Ser351) Polyclonal Antibody

Sign In for Pricing
View Details