Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF-2/FGF-10, Mouse

KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.

Product Specifications

Product Name Alternative

KGF-2/FGF-10 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-2-fgf-10-protein-mouse.html

Purity

95.00

Smiles

SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT

Molecular Formula

14165 (Gene_ID) O35565 (S62-T209) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nomura S, et al. FGF10/FGFR2 signal induces cell migration and invasion in pancreatic cancer. Br J Cancer. 2008 Jul 22;99 (2) :305-13.|[2]Bagai S, et al. Fibroblast growth factor-10 is a mitogen for urothelial cells. J Biol Chem. 2002 Jun 28;277 (26) :23828-37.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Strad Antibody
C11258-01 50 μL

Strad Antibody

Sign In for Pricing
View Details
Strad Antibody
C11258-02 100 µL

Strad Antibody

Sign In for Pricing
View Details
N2-Carboxy-N- (carboxymethyl) asparagine Tribenzyl Ester
460315-01 250 mg

N2-Carboxy-N- (carboxymethyl) asparagine Tribenzyl Ester

Sign In for Pricing
View Details
N2-Carboxy-N- (carboxymethyl) asparagine Tribenzyl Ester
460315-02 2.5 g

N2-Carboxy-N- (carboxymethyl) asparagine Tribenzyl Ester

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)
MBS2128352-01 0.1 mL

PE Linked Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)
MBS2128352-02 0.2 mL

PE Linked Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details