Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF-2/FGF-10, Mouse

KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.

Product Specifications

Product Name Alternative

KGF-2/FGF-10 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-2-fgf-10-protein-mouse.html

Purity

95.00

Smiles

SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT

Molecular Formula

14165 (Gene_ID) O35565 (S62-T209) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nomura S, et al. FGF10/FGFR2 signal induces cell migration and invasion in pancreatic cancer. Br J Cancer. 2008 Jul 22;99 (2) :305-13.|[2]Bagai S, et al. Fibroblast growth factor-10 is a mitogen for urothelial cells. J Biol Chem. 2002 Jun 28;277 (26) :23828-37.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human MYH14 sgRNA gene knockout kit - Lentiviral human MYH14 sgRNA gene knockout kit (100)
GTR15394516 1 Vial

Lentiviral human MYH14 sgRNA gene knockout kit - Lentiviral human MYH14 sgRNA gene knockout kit (100)

Ask
View Details
Rabbit Polyclonal MYBPC1 Antibody [DyLight 594]
NBP2-98527DL594 0.1 mL

Rabbit Polyclonal MYBPC1 Antibody [DyLight 594]

Ask
View Details
BCL2-associated Transcription Factor 1 (BCLAF1) Rabbit anti-Human Polyclonal (aa700-750) Antibody
GWB-A09711 0.05 mg

BCL2-associated Transcription Factor 1 (BCLAF1) Rabbit anti-Human Polyclonal (aa700-750) Antibody

Ask
View Details
Rat Fam219b Pre-designed siRNA Set B
SI204804B 1 Each

Rat Fam219b Pre-designed siRNA Set B

Ask
View Details